PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma148g00360.1
Common NameZOSMA_148G00360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 1800aa    MW: 202703 Da    PI: 5.0983
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma148g00360.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.93.1e-174397357
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      kR   t++qle Le+ ++  +yps++ r+eL+ kl+L++rq ++WF+ rR k++k
  Zosma148g00360.1 43 KRKMKTAYQLELLEKTYATASYPSEAVRAELSVKLDLSDRQLQMWFCHRRLKDRK 97
                      89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-151998IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-172397IPR009057Homeodomain-like
PROSITE profilePS5007115.8073898IPR001356Homeobox domain
SMARTSM003894.1E-1540102IPR001356Homeobox domain
CDDcd000864.89E-124397No hitNo description
PfamPF000468.8E-154397IPR001356Homeobox domain
PROSITE profilePS5082717.013578637IPR018501DDT domain
SMARTSM005714.4E-22578637IPR018501DDT domain
PfamPF027912.2E-18579634IPR018501DDT domain
PfamPF050667.2E-14760827IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.8E-59691013IPR028942WHIM1 domain
PfamPF156132.6E-1311461218IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1800 aa     Download sequence    Send to blast
MEVSDGDESG EKSLPLLPQP PQPAPPPPPK TEGAGGSGEK STKRKMKTAY QLELLEKTYA  60
TASYPSEAVR AELSVKLDLS DRQLQMWFCH RRLKDRKASE MAAATPAGGG SVSCSGSSSH  120
QEPRKALARM YAPSSSRMIA EPPPVPPPPL SQSIVRSRYY DVMPLPHHSV SELNVVAFVE  180
SQLGERIRED GPILGMVFDP LPPGAFGAPL EPTVQQKHPG RSYDAELFEG HDTKSFKTSS  240
FLPSTEHCLI TSSSTGKRKA KMAHSQLVKR PVHEYQFLPE QPSARSDGYG RIPSSHLYDP  300
SIDDTGNRLS PLQSGRLFVH DNDRMPIKQG THHNFPSSSM EYDGYHHKAL YSNSGIDAPF  360
SSQHAIGIEN PFLTPDRRMN REEDGAPIER KRKSEEARIA KEVEAHEKRI RKELEKQDIL  420
RRKREENMRK EMERHGREKK KEEERLLREK QREEERYQRE LKREQERRER FLQKENQRAE  480
KIRLKEEIRR EKEAAKIKAA NERATARRIA REYMDLIEDE RLELMEHAAS SKELPSITSL  540
DSETLQNLNL FQDMLKEFPP KSVSLKQPFA IQPWANSEEN IGNLLMVWRF LITFADVLSL  600
WPFTLDEFVQ ALHDYDPRLL GEILIALLKC IIKDIEDVAR TPATSLGGNH SSAVNPSGGH  660
PQVIEGAYAW GFDIRSWQTH LNPLTWPEIL RQFALSAGFG PQLKKRIVEK SYYRDENEGH  720
DGEDIVSTLR SGMAAENALA VMQEKGFSQS RKSRHRLTPG TVKFAAFHVL SLEGDNSLTI  780
LEVADKIQAS GLRDLTTSKT PEASIAAALS RDTKLFERTA PSTYCVRPAY RKDPSDAEAI  840
LAAAREKIQI FENGFSESEE AEKDTVFVDE TERDEVSESD GADDLEIDGV NPQRNFAEVP  900
NHYEVKSATT SACLGNGNNI NYDGMDPHGS TGNLDETKDG IISGAQKTHL LDISEEKVKV  960
DDTEIDESNS GEPWVQGLME GEYSDISVEE RLNSLVSLVS VAIEGNTIRV ILEERMEAAN  1020
ALKKQMWAEA QLDKRRMKEE YMSRLEFSSI GMKTEVINPD IDGSHNLFNG VDNKGSVINL  1080
NASVNGEPFD LENPNSMIVE KNMAGQEITA YPDGFQPQQN GNMAEKSRSQ LKAYIGHKAE  1140
QVHVYRSLPL GQDRRRNRYW QFTASASKND PGSGRIFFES RDGFWRVIDS EEVFDCLIAS  1200
LDTRGVRESH LHTMLQKIES SFKEAIRNNC RGDTLSSSRV LKTKSVEMTS SPDFGIVMDS  1260
PQSTVCVLTS DASEQSSTFK VELGRNDVEK NTALKRYQDF QRWVWNESFN PTVTCAMKFG  1320
KKRCLEVLGT CNSCFESHFS EEKHCSLCHR TFKICYNFEN FFSDHVSQCE DNRKIDPSAT  1380
IQCSNSSLPI RFQIIKTLLA NIEASIPSEA LQPFWTDDFR KSWSVKLHIS STAEDLFQML  1440
TLLENTINRD CLSSNYETTN ELLGCSMAVI NDGLVPVLPW IPHTTAAVAL RLMDLDASIF  1500
YALDQKAESL KEKDSGELIK LPTKGYTANE IIDFEANEME IHKEFPPESN NLAESVIRSS  1560
STRGRGRGTR GRGRGGRPRG STSSTRSEFK EERIKSSLRT KRRQPKCKTR GRGRSRGRRT  1620
VRPRQIPSRT NKVDGGLIGK NTHQGGFLNI SNDHRSVARG SLESSEEREE WNGMEIPQAY  1680
AEEEDNTVGY SGSDDNNGLA SGDEYDEQTP VDYSLRVYGN TKHRTILDDE SEEDDIDRET  1740
ADNVDDDGDR DYANEDMEDD LEDDDDIIEV DGDETADFDR NGNDEDDGND ASYSSEYSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008811887.10.0PREDICTED: uncharacterized protein LOC103722930 isoform X1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A0K9PZ170.0A0A0K9PZ17_Z
STRINGPOPTR_0007s01330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator